KATALOG STRON ISTNIEJE OD 2005 ROKU      PR 5       BL 3990K +      CF 43      TF 38

Sprawdź ofertę

polecanej strony!

Zapoznaj się z ofertą poniżej dodanej strony.

Wyróżnij wpis: kancelariakredytywefrankach.pl

Chcesz zareklamować swoją stronę w całym naszym katalogu na wszystkich podstronach? Wybierz z poniższej listy wpis premium:

  • Wpis może znajdować się w 1 kategoriach

5.00 PLN - płatność przelewem z VAT: DOTPAY.pl Reklamacje DOTPAY.pl Właścicielem serwisu jest firma Allf.


Grupa Allf, to 20 katalogów, istniejących od wielu lat! Nasze katalogi charakteryzują się wysokich wskaźnikami Trust Flow, Citation Flow, Page Authority, Domain Authority. Wszystkie mają zainstalowane certyfikaty SSL. Można dodawać strony zarówno z https, jak i z http. Katalogi przystosowane do wyświetlania na telefonach i tabletach. Więcej informacji o ofercie Multikodu znajdziesz tutaj. Dodaj kolejne wpisy jednym kodem, to się po prostu opłaca! Jeden Multikod to wpis we wszystkich 20 katalogach! Wpisy zostaną wyróżnione na okres 30 dni, następnie będą umieszczone w pakiecie Plus Możesz zaoszczędzić nawet 21.00 pln!

Dodaj swoją firmę już dziś

i pozyskuj nowych klientów
Dodaj firmę +